![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.0: automated matches [194949] (1 protein) not a true family |
![]() | Protein automated matches [194950] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [194951] (1 PDB entry) |
![]() | Domain d4doha1: 4doh A:25-176 [201725] Other proteins in same PDB: d4doha2, d4dohc2 automated match to d4dohc_ complexed with nag |
PDB Entry: 4doh (more details), 2.8 Å
SCOPe Domain Sequences for d4doha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4doha1 a.26.1.0 (A:25-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktlnlgscviatnlqeirngfseirgsvqakdgnidirilrrteslqdtkpanrccllr hllrlyldrvfknyqtpdhytlrkisslansfltikkdlrlchahmtchcgeeamkkysq ilshfeklepqaavvkalgeldillqwmeete
Timeline for d4doha1: