Lineage for d4do1c_ (4do1 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278217Species Rhodopseudomonas palustris [TaxId:316058] [193594] (5 PDB entries)
  8. 1278224Domain d4do1c_: 4do1 C: [201724]
    automated match to d4do1d_
    complexed with ann, cl, gol, hem, so4

Details for d4do1c_

PDB Entry: 4do1 (more details), 2 Å

PDB Description: The crystal structures of 4-methoxybenzoate bound CYP199A4
PDB Compounds: (C:) cytochrome p450

SCOPe Domain Sequences for d4do1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do1c_ a.104.1.0 (C:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4do1c_:

Click to download the PDB-style file with coordinates for d4do1c_.
(The format of our PDB-style files is described here.)

Timeline for d4do1c_: