Lineage for d4do1b_ (4do1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005837Species Rhodopseudomonas palustris [TaxId:316058] [193594] (6 PDB entries)
  8. 2005843Domain d4do1b_: 4do1 B: [201723]
    automated match to d4do1d_
    complexed with ann, cl, gol, hem, so4

Details for d4do1b_

PDB Entry: 4do1 (more details), 2 Å

PDB Description: The crystal structures of 4-methoxybenzoate bound CYP199A4
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d4do1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do1b_ a.104.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4do1b_:

Click to download the PDB-style file with coordinates for d4do1b_.
(The format of our PDB-style files is described here.)

Timeline for d4do1b_: