Lineage for d4dnga_ (4dng A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141154Species Bacillus subtilis [TaxId:1423] [196003] (2 PDB entries)
  8. 2141155Domain d4dnga_: 4dng A: [201720]
    automated match to d4dngb_

Details for d4dnga_

PDB Entry: 4dng (more details), 2.5 Å

PDB Description: Crystal structure of putative aldehyde dehydrogenase from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) Uncharacterized aldehyde dehydrogenase AldY

SCOPe Domain Sequences for d4dnga_:

Sequence, based on SEQRES records: (download)

>d4dnga_ c.82.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
elggvkevpsdiegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdi
qtaisggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhig
eiagrafkrmalelggnnpfavlsdadvdravdaaifgkfihqgqicmiinriivhqdvy
defvekftarvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvg
nvltpyvfvgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlek
gekfalqidsgmthvndqsvndspniafggnkasgvgrfgnpwvveeftvtkwisiqk

Sequence, based on observed residues (ATOM records): (download)

>d4dnga_ c.82.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
elggvkevpsdiegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdi
qtaisggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhig
eiagrafkrmalelggnnpfavlsdadvdravdaaifgkfihqmiinriivhqdvydefv
ekftarvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvgnvlt
pyvfvgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlekgekf
alqidsgmthvndqnpwvveeftvtkwisiqk

SCOPe Domain Coordinates for d4dnga_:

Click to download the PDB-style file with coordinates for d4dnga_.
(The format of our PDB-style files is described here.)

Timeline for d4dnga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4dngb_