SCOP 1.63: Domain d2hrpm1: 2hrp M:1-107

Lineage for d2hrpm1 (2hrp M:1-107)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Fab F11.2.32 (mouse), kappa L chain [48834] (2 PDB entries)
against HIV-1 protease
Domain d2hrpm1: 2hrp M:1-107 [20172]
Other proteins in same PDB: d2hrph2, d2hrpl2, d2hrpm2, d2hrpn2

Details for d2hrpm1

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrpm1 b.1.1.1 (M:1-107) Immunoglobulin (variable domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleik

SCOP Domain Coordinates for d2hrpm1:

Click to download the PDB-style file with coordinates for d2hrpm1.
(The format of our PDB-style files is described here.)

Timeline for d2hrpm1: