SCOPe 2.06: Domain d4dkyb1: 4dky B:1-98

Lineage for d4dkyb1 (4dky B:1-98)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries)

8. Domain d4dkyb1: 4dky B:1-98 [201717]
   Other proteins in same PDB: d4dkyb2
   automated match to d4dkya_
   complexed with mn

Details for d4dkyb1

PDB Entry: 4dky, 2.48 Å

PDB Description: Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]

PDB Compounds: (B:) DNA-binding protein HU homolog

SCOPe Domain Sequences for d4dkyb1:

Sequence; same for both SEQRES and ATOM records:

>d4dkyb1 a.55.1.0 (B:1-98) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpae

Timeline for d4dkyb1:

• d4dkyb1 first appeared in SCOPe 2.03, called d4dkyb_
  
• d4dkyb1 was called d4dkyb_ in SCOPe 2.05
  
• d4dkyb1 appears in SCOPe 2.07
  
• d4dkyb1 appears in the current release, SCOPe 2.08