SCOPe 2.03: Domain d4dkyb_: 4dky B:

Lineage for d4dkyb_ (4dky B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188755] (2 PDB entries)

8. Domain d4dkyb_: 4dky B: [201717]
   automated match to d4dkya_
   complexed with mn

Details for d4dkyb_

PDB Entry: 4dky, 2.48 Å

PDB Description: Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]

PDB Compounds: (B:) DNA-binding protein HU homolog

SCOPe Domain Sequences for d4dkyb_:

Sequence, based on SEQRES records:

>d4dkyb_ a.55.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaegphhhh

Sequence, based on observed residues (ATOM records):

>d4dkyb_ a.55.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaehhh

Timeline for d4dkyb_:

• d4dkyb_ is new in SCOPe 2.03-stable
  
• d4dkyb_ appears in SCOPe 2.04
  
• d4dkyb_ appears in the current release, SCOPe 2.08, called d4dkyb1