SCOPe 2.06: Domain d4dj8e1: 4dj8 E:1-316

Lineage for d4dj8e1 (4dj8 E:1-316)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (25 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)

8. Domain d4dj8e1: 4dj8 E:1-316 [201716]
   Other proteins in same PDB: d4dj8b_, d4dj8d_, d4dj8e2, d4dj8f_
   automated match to d4dj8c_
   complexed with nag, sia

Details for d4dj8e1

PDB Entry: 4dj8, 2.8 Å

PDB Description: structure of the hemagglutinin complexed with 6sln from a highly pathogenic h7n7 influenza virus

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4dj8e1:

Sequence; same for both SEQRES and ATOM records:

>d4dj8e1 b.19.1.2 (E:1-316) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslllatgmknvpe

Timeline for d4dj8e1:

• d4dj8e1 first appeared in SCOPe 2.03, called d4dj8e_
  
• d4dj8e1 was called d4dj8e_ in SCOPe 2.05
  
• d4dj8e1 appears in SCOPe 2.07
  
• d4dj8e1 appears in the current release, SCOPe 2.08