Lineage for d4diec1 (4die C:2-218)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128928Species Mycobacterium abscessus [TaxId:561007] [189689] (2 PDB entries)
  8. 2128933Domain d4diec1: 4die C:2-218 [201715]
    Other proteins in same PDB: d4diea2, d4dieb2, d4diec2, d4died2
    automated match to d3r8ca_
    complexed with c5p, po4

Details for d4diec1

PDB Entry: 4die (more details), 2.65 Å

PDB Description: crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate
PDB Compounds: (C:) Cytidylate kinase

SCOPe Domain Sequences for d4diec1:

Sequence, based on SEQRES records: (download)

>d4diec1 c.37.1.0 (C:2-218) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqrrdhlds
travsplrpaedalevdtsdmtqeqvvahlldlvrtr

Sequence, based on observed residues (ATOM records): (download)

>d4diec1 c.37.1.0 (C:2-218) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsekvladvqrrdhldstravspl
rpaedalevdtsdmtqeqvvahlldlvrtr

SCOPe Domain Coordinates for d4diec1:

Click to download the PDB-style file with coordinates for d4diec1.
(The format of our PDB-style files is described here.)

Timeline for d4diec1: