Lineage for d4diea1 (4die A:2-217)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872583Species Mycobacterium abscessus [TaxId:561007] [189689] (2 PDB entries)
  8. 2872586Domain d4diea1: 4die A:2-217 [201713]
    Other proteins in same PDB: d4diea2, d4dieb2, d4diec2, d4died2
    automated match to d3r8ca_
    complexed with c5p, po4

Details for d4diea1

PDB Entry: 4die (more details), 2.65 Å

PDB Description: crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d4diea1:

Sequence, based on SEQRES records: (download)

>d4diea1 c.37.1.0 (A:2-217) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqrrdhlds
travsplrpaedalevdtsdmtqeqvvahlldlvrt

Sequence, based on observed residues (ATOM records): (download)

>d4diea1 c.37.1.0 (A:2-217) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaatdqv
pmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaessgav
vvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvladvqrrdhldstrlrpaedale
vdtsdmtqeqvvahlldlvrt

SCOPe Domain Coordinates for d4diea1:

Click to download the PDB-style file with coordinates for d4diea1.
(The format of our PDB-style files is described here.)

Timeline for d4diea1: