Lineage for d4dhjn_ (4dhj N:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407022Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (4 PDB entries)
  8. 1407028Domain d4dhjn_: 4dhj N: [201709]
    Other proteins in same PDB: d4dhjb_, d4dhjd_, d4dhjf_, d4dhjh_, d4dhjj_, d4dhjm_
    automated match to d1j7db_

Details for d4dhjn_

PDB Entry: 4dhj (more details), 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
PDB Compounds: (N:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhjn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhjn_ d.20.1.1 (N:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamnn

SCOPe Domain Coordinates for d4dhjn_:

Click to download the PDB-style file with coordinates for d4dhjn_.
(The format of our PDB-style files is described here.)

Timeline for d4dhjn_: