SCOPe 2.06: Domain d4dhea1: 4dhe A:1-206

Lineage for d4dhea1 (4dhe A:1-206)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries)

8. Domain d4dhea1: 4dhe A:1-206 [201700]
   Other proteins in same PDB: d4dhea2, d4dheb2
   automated match to d4dheb_
   complexed with cl

Details for d4dhea1

PDB Entry: 4dhe, 2.2 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB from Burkholderia thailandensis

PDB Compounds: (A:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d4dhea1:

Sequence; same for both SEQRES and ATOM records:

>d4dhea1 c.37.1.0 (A:1-206) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafasktpgr
tqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmilmmd
arrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdagyagk
ltvqlfsalkrtglddahalieswlr

Timeline for d4dhea1:

• d4dhea1 first appeared in SCOPe 2.03, called d4dhea_
  
• d4dhea1 was called d4dhea_ in SCOPe 2.05
  
• d4dhea1 appears in SCOPe 2.07
  
• d4dhea1 appears in the current release, SCOPe 2.08