SCOPe 2.05: Domain d4dhea_: 4dhe A:

Lineage for d4dhea_ (4dhe A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries)

8. Domain d4dhea_: 4dhe A: [201700]
   automated match to d4dheb_
   complexed with cl

Details for d4dhea_

PDB Entry: 4dhe, 2.2 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB from Burkholderia thailandensis

PDB Compounds: (A:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d4dhea_:

Sequence; same for both SEQRES and ATOM records:

>d4dhea_ c.37.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafasktp
grtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmilm
mdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdagya
gkltvqlfsalkrtglddahalieswlr

Timeline for d4dhea_:

• d4dhea_ first appeared in SCOPe 2.03
  
• d4dhea_ appears in SCOPe 2.04
  
• d4dhea_ is called d4dhea1 in SCOPe 2.06
  
• d4dhea_ appears in the current release, SCOPe 2.08, called d4dhea1