SCOPe 2.06: Domain d4dgjd_: 4dgj D:

Lineage for d4dgjd_ (4dgj D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)

8. Domain d4dgjd_: 4dgj D: [201697]
   automated match to d4dgjc_

Details for d4dgjd_

PDB Entry: 4dgj, 1.9 Å

PDB Description: structure of a human enteropeptidase light chain variant

PDB Compounds: (D:) Enteropeptidase catalytic light chain

SCOPe Domain Sequences for d4dgjd_:

Sequence; same for both SEQRES and ATOM records:

>d4dgjd_ b.47.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh
mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf
ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi
dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsfl

Timeline for d4dgjd_:

• d4dgjd_ first appeared in SCOPe 2.03
  
• d4dgjd_ appears in SCOPe 2.05
  
• d4dgjd_ appears in SCOPe 2.07
  
• d4dgjd_ appears in the current release, SCOPe 2.08