Lineage for d4dgjd_ (4dgj D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794921Protein automated matches [190044] (14 species)
    not a true protein
  7. 1794960Species Human (Homo sapiens) [TaxId:9606] [187233] (136 PDB entries)
  8. 1795000Domain d4dgjd_: 4dgj D: [201697]
    automated match to d4dgjc_

Details for d4dgjd_

PDB Entry: 4dgj (more details), 1.9 Å

PDB Description: structure of a human enteropeptidase light chain variant
PDB Compounds: (D:) Enteropeptidase catalytic light chain

SCOPe Domain Sequences for d4dgjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgjd_ b.47.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh
mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf
ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi
dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsfl

SCOPe Domain Coordinates for d4dgjd_:

Click to download the PDB-style file with coordinates for d4dgjd_.
(The format of our PDB-style files is described here.)

Timeline for d4dgjd_: