Lineage for d4dg4g_ (4dg4 G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794723Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries)
  8. 1794732Domain d4dg4g_: 4dg4 G: [201696]
    Other proteins in same PDB: d4dg4c_, d4dg4e_, d4dg4f_, d4dg4h_
    automated match to d4dg4b_
    complexed with ca, so4

Details for d4dg4g_

PDB Entry: 4dg4 (more details), 1.4 Å

PDB Description: human mesotrypsin-s39y complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (G:) PRSS3 protein

SCOPe Domain Sequences for d4dg4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dg4g_ b.47.1.2 (G:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgyhfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d4dg4g_:

Click to download the PDB-style file with coordinates for d4dg4g_.
(The format of our PDB-style files is described here.)

Timeline for d4dg4g_: