Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries) |
Domain d4dg4g_: 4dg4 G: [201696] Other proteins in same PDB: d4dg4c_, d4dg4e_, d4dg4f_, d4dg4h_ automated match to d4dg4b_ complexed with ca, so4 |
PDB Entry: 4dg4 (more details), 1.4 Å
SCOPe Domain Sequences for d4dg4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dg4g_ b.47.1.2 (G:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]} ivggytceenslpyqvslnsgyhfcggsliseqwvvsaahcyktriqvrlgehnikvleg neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d4dg4g_: