Lineage for d4dg4a_ (4dg4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796578Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries)
  8. 2796587Domain d4dg4a_: 4dg4 A: [201694]
    Other proteins in same PDB: d4dg4c_, d4dg4e_, d4dg4f_, d4dg4h_
    automated match to d4dg4b_
    complexed with ca, so4

Details for d4dg4a_

PDB Entry: 4dg4 (more details), 1.4 Å

PDB Description: human mesotrypsin-s39y complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (A:) PRSS3 protein

SCOPe Domain Sequences for d4dg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dg4a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgyhfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d4dg4a_:

Click to download the PDB-style file with coordinates for d4dg4a_.
(The format of our PDB-style files is described here.)

Timeline for d4dg4a_: