Lineage for d4desb_ (4des B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365078Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2365079Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2365080Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2365101Species Human (Homo sapiens) [TaxId:9606] [49475] (285 PDB entries)
    Uniprot P02766 31-143
  8. 2365347Domain d4desb_: 4des B: [201692]
    automated match to d3i9pa_
    complexed with 57d

Details for d4desb_

PDB Entry: 4des (more details), 1.75 Å

PDB Description: Crystal Structure of the Wild Type TTR Binding Chrysin (TTRwt:CHR)
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4desb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4desb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d4desb_:

Click to download the PDB-style file with coordinates for d4desb_.
(The format of our PDB-style files is described here.)

Timeline for d4desb_: