Lineage for d1hyyh1 (1hyy H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362910Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)
  8. 362914Domain d1hyyh1: 1hyy H:1-113 [20169]
    Other proteins in same PDB: d1hyyh2, d1hyyl1, d1hyyl2
    part of hydrolytic antibody 6D9
    complexed with cpd

Details for d1hyyh1

PDB Entry: 1hyy (more details), 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyyh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evkllesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ss

SCOP Domain Coordinates for d1hyyh1:

Click to download the PDB-style file with coordinates for d1hyyh1.
(The format of our PDB-style files is described here.)

Timeline for d1hyyh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyyh2