![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
![]() | Protein automated matches [190516] (4 species) not a true protein |
![]() | Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries) |
![]() | Domain d4ddna_: 4ddn A: [201687] automated match to d4ddnb_ complexed with amg |
PDB Entry: 4ddn (more details), 1.9 Å
SCOPe Domain Sequences for d4ddna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ddna_ b.77.3.0 (A:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]} malqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptd iitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganag tpfnikipdgnkivgffgnsgwyvdaigayytak
Timeline for d4ddna_: