SCOPe 2.05: Domain d4ddna_: 4ddn A:

Lineage for d4ddna_ (4ddn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (2 species)
   not a true protein

7. Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries)

8. Domain d4ddna_: 4ddn A: [201687]
   automated match to d4ddnb_
   complexed with amg

Details for d4ddna_

PDB Entry: 4ddn, 1.9 Å

PDB Description: structure analysis of a wound-inducible lectin ipomoelin from sweet potato

PDB Compounds: (A:) Ipomoelin

SCOPe Domain Sequences for d4ddna_:

Sequence; same for both SEQRES and ATOM records:

>d4ddna_ b.77.3.0 (A:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
malqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptd
iitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganag
tpfnikipdgnkivgffgnsgwyvdaigayytak

Timeline for d4ddna_:

• d4ddna_ first appeared in SCOPe 2.03
  
• d4ddna_ appears in SCOPe 2.04
  
• d4ddna_ appears in SCOPe 2.06
  
• d4ddna_ appears in the current release, SCOPe 2.08