Lineage for d4dasp_ (4das P:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315472Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)
  8. 2315502Domain d4dasp_: 4das P: [201675]
    automated match to d3ka4a_
    complexed with edo, pge

Details for d4dasp_

PDB Entry: 4das (more details), 2.56 Å

PDB Description: Crystal structure of Bullfrog M ferritin
PDB Compounds: (P:) Ferritin, middle subunit

SCOPe Domain Sequences for d4dasp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dasp_ a.25.1.1 (P:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d4dasp_:

Click to download the PDB-style file with coordinates for d4dasp_.
(The format of our PDB-style files is described here.)

Timeline for d4dasp_: