Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab 6D9 (mouse), kappa L chain [48833] (2 PDB entries) |
Domain d1hyxl1: 1hyx L:1-107 [20166] Other proteins in same PDB: d1hyxh2, d1hyxl2 |
PDB Entry: 1hyx (more details), 1.8 Å
SCOP Domain Sequences for d1hyxl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyxl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 6D9 (mouse), kappa L chain} elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik
Timeline for d1hyxl1: