Lineage for d4dami_ (4dam I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060603Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry)
  8. 2060612Domain d4dami_: 4dam I: [201657]
    Other proteins in same PDB: d4dama2, d4damc2, d4dame2, d4damg2, d4damk2
    automated match to d4dama_

Details for d4dami_

PDB Entry: 4dam (more details), 1.7 Å

PDB Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
PDB Compounds: (I:) Single-stranded DNA-binding protein 1

SCOPe Domain Sequences for d4dami_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dami_ b.40.4.0 (I:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg

SCOPe Domain Coordinates for d4dami_:

Click to download the PDB-style file with coordinates for d4dami_.
(The format of our PDB-style files is described here.)

Timeline for d4dami_: