Lineage for d4damh_ (4dam H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542252Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry)
  8. 1542260Domain d4damh_: 4dam H: [201656]
    automated match to d4dama_

Details for d4damh_

PDB Entry: 4dam (more details), 1.7 Å

PDB Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
PDB Compounds: (H:) Single-stranded DNA-binding protein 1

SCOPe Domain Sequences for d4damh_:

Sequence, based on SEQRES records: (download)

>d4damh_ b.40.4.0 (H:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg

Sequence, based on observed residues (ATOM records): (download)

>d4damh_ b.40.4.0 (H:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreawtdghtnfftvwanrqla
tnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg

SCOPe Domain Coordinates for d4damh_:

Click to download the PDB-style file with coordinates for d4damh_.
(The format of our PDB-style files is described here.)

Timeline for d4damh_: