Lineage for d2bfvh_ (2bfv H:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) 
Species Fv 4155 (mouse), kappa L chain [48832] (3 PDB entries) 
Domain d2bfvh_: 2bfv H: [20165]
Details for d2bfvh_
PDB Entry: 2bfv (more details), 2.5 Å
PDB Description: monoclonal antibody fragment fv4155 from e. coli
SCOP Domain Sequences for d2bfvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv 4155 (mouse), kappa L chain}
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
SCOP Domain Coordinates for d2bfvh_:
Click to download the PDB-style file with coordinates for d2bfvh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bfvh_:
- d2bfvh_ first appeared (with stable ids) in SCOP 1.55
- d2bfvh_ appears in SCOP 1.59
- d2bfvh_ appears in the current release, SCOPe 2.08, called d2bfvh1
View in 3D
