SCOPe 2.07: Domain d4d9qa_: 4d9q A:

Lineage for d4d9qa_ (4d9q A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Macaca mulatta [TaxId:9541] [196009] (1 PDB entry)

8. Domain d4d9qa_: 4d9q A: [201645]
   Other proteins in same PDB: d4d9qd1, d4d9qd2, d4d9ql1, d4d9ql2
   automated match to d4d9qb_
   complexed with gol, so4, zn

Details for d4d9qa_

PDB Entry: 4d9q, 2.28 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d

PDB Compounds: (A:) factor d

SCOPe Domain Sequences for d4d9qa_:

Sequence; same for both SEQRES and ATOM records:

>d4d9qa_ b.47.1.2 (A:) automated matches {Macaca mulatta [TaxId: 9541]}
ilggreaeaharpymasvqvngehlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsrpdtidhdllllqlsekatlgpavrplpwqrvdrdvepg
tlcdvagwgivshagrrpdrlqhvllpvldratcnrrthhdgaitqrmmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Timeline for d4d9qa_:

• d4d9qa_ first appeared in SCOPe 2.03
  
• d4d9qa_ appears in SCOPe 2.06
  
• d4d9qa_ appears in the current release, SCOPe 2.08