Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Macaca mulatta [TaxId:9541] [196009] (1 PDB entry) |
Domain d4d9qa_: 4d9q A: [201645] Other proteins in same PDB: d4d9qd1, d4d9qd2, d4d9ql1, d4d9ql2 automated match to d4d9qb_ complexed with gol, so4, zn |
PDB Entry: 4d9q (more details), 2.28 Å
SCOPe Domain Sequences for d4d9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9qa_ b.47.1.2 (A:) automated matches {Macaca mulatta [TaxId: 9541]} ilggreaeaharpymasvqvngehlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsrpdtidhdllllqlsekatlgpavrplpwqrvdrdvepg tlcdvagwgivshagrrpdrlqhvllpvldratcnrrthhdgaitqrmmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d4d9qa_: