Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50049] (16 PDB entries) |
Domain d4d8dc_: 4d8d C: [201642] Other proteins in same PDB: d4d8db_, d4d8dd_ automated match to d4d8da_ complexed with gol |
PDB Entry: 4d8d (more details), 2.52 Å
SCOPe Domain Sequences for d4d8dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d8dc_ b.34.2.1 (C:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} vtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
Timeline for d4d8dc_: