Lineage for d4d8dc_ (4d8d C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783547Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)
  7. 1783551Species Human (Homo sapiens) [TaxId:9606] [50049] (16 PDB entries)
  8. 1783562Domain d4d8dc_: 4d8d C: [201642]
    Other proteins in same PDB: d4d8db_, d4d8dd_
    automated match to d4d8da_
    complexed with gol

Details for d4d8dc_

PDB Entry: 4d8d (more details), 2.52 Å

PDB Description: crystal structure of hiv-1 nef fyn-sh3 r96w variant
PDB Compounds: (C:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d4d8dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8dc_ b.34.2.1 (C:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
vtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv

SCOPe Domain Coordinates for d4d8dc_:

Click to download the PDB-style file with coordinates for d4d8dc_.
(The format of our PDB-style files is described here.)

Timeline for d4d8dc_: