Lineage for d4bi5m_ (4bi5 M:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1566289Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1566290Protein automated matches [190605] (13 species)
    not a true protein
  7. 1566310Species Giardia intestinalis [TaxId:5741] [187625] (5 PDB entries)
  8. 1566327Domain d4bi5m_: 4bi5 M: [201632]
    mutant

Details for d4bi5m_

PDB Entry: 4bi5 (more details), 2.7 Å

PDB Description: crystal structure of a double mutant (c202a and c222d) of triosephosphate isomerase from giardia lamblia.
PDB Compounds: (M:) triosephosphate isomerase

SCOPe Domain Sequences for d4bi5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bi5m_ c.1.1.0 (M:) automated matches {Giardia intestinalis [TaxId: 5741]}
parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsndeklgqcpnidgflvggasl
kpefmtmidiltkt

SCOPe Domain Coordinates for d4bi5m_:

Click to download the PDB-style file with coordinates for d4bi5m_.
(The format of our PDB-style files is described here.)

Timeline for d4bi5m_: