SCOPe 2.08: Domain d4bhxb1: 4bhx B:3-92

Lineage for d4bhxb1 (4bhx B:3-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries)

8. Domain d4bhxb1: 4bhx B:3-92 [201624]
   Other proteins in same PDB: d4bhxa2, d4bhxb2
   automated match to d4bhxa_
   complexed with edo, peg, pge

Details for d4bhxb1

PDB Entry: 4bhx, 1.95 Å

PDB Description: crystal structure of the scan domain from human paternally expressed gene 3 protein

PDB Compounds: (B:) paternally-expressed gene 3 protein

SCOPe Domain Sequences for d4bhxb1:

Sequence; same for both SEQRES and ATOM records:

>d4bhxb1 a.28.3.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdseffhqrfrnliyvefvgprktliklrnlcldwlqpetrtkeeiiellvleqyltiip
eklkpwvrakkpenceklvtllenykemyq

Timeline for d4bhxb1:

• d4bhxb1 first appeared in SCOPe 2.03, called d4bhxb_
  
• d4bhxb1 appears in SCOPe 2.07