SCOPe 2.07: Domain d4bfub_: 4bfu B:

Lineage for d4bfub_ (4bfu B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries)

8. Domain d4bfub_: 4bfu B: [201620]
   automated match to d4bfza_
   complexed with po4, zvu

Details for d4bfub_

PDB Entry: 4bfu, 2.28 Å

PDB Description: crystal structure of mycobacterium tuberculosis pank in complex with a triazole inhibitory compound (1c) and phosphate

PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d4bfub_:

Sequence; same for both SEQRES and ATOM records:

>d4bfub_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
fadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
lrlrkl

Timeline for d4bfub_:

• d4bfub_ first appeared in SCOPe 2.03
  
• d4bfub_ appears in SCOPe 2.06
  
• d4bfub_ appears in the current release, SCOPe 2.08