Lineage for d1bfvl_ (1bfv L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219976Species Fv 4155 (mouse), kappa L chain [48832] (3 PDB entries)
  8. 219980Domain d1bfvl_: 1bfv L: [20162]

Details for d1bfvl_

PDB Entry: 1bfv (more details), 2.1 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli
PDB Compounds: (L:)

SCOP Domain Sequences for d1bfvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfvl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv 4155 (mouse), kappa L chain}
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr

SCOP Domain Coordinates for d1bfvl_:

Click to download the PDB-style file with coordinates for d1bfvl_.
(The format of our PDB-style files is described here.)

Timeline for d1bfvl_: