Lineage for d4bfbd1 (4bfb D:165-270)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347729Domain d4bfbd1: 4bfb D:165-270 [201618]
    Other proteins in same PDB: d4bfba_, d4bfbb_, d4bfbd2, d4bfbe2
    automated match to d3ezjb_
    complexed with b3p

Details for d4bfbd1

PDB Entry: 4bfb (more details), 2.21 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (D:) xa4813

SCOPe Domain Sequences for d4bfbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bfbd1 b.1.1.1 (D:165-270) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs

SCOPe Domain Coordinates for d4bfbd1:

Click to download the PDB-style file with coordinates for d4bfbd1.
(The format of our PDB-style files is described here.)

Timeline for d4bfbd1: