| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d4bfbd1: 4bfb D:165-270 [201618] Other proteins in same PDB: d4bfba_, d4bfbb_, d4bfbd2, d4bfbe2 automated match to d3ezjb_ complexed with b3p |
PDB Entry: 4bfb (more details), 2.21 Å
SCOPe Domain Sequences for d4bfbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bfbd1 b.1.1.1 (D:165-270) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs
Timeline for d4bfbd1:
View in 3DDomains from other chains: (mouse over for more information) d4bfba_, d4bfbb_, d4bfbe1, d4bfbe2 |