SCOPe 2.08: Domain d4bfbd1: 4bfb D:165-270

Lineage for d4bfbd1 (4bfb D:165-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4bfbd1: 4bfb D:165-270 [201618]
   Other proteins in same PDB: d4bfba_, d4bfbb_, d4bfbd2, d4bfbe2
   automated match to d3ezjb_
   complexed with b3p

Details for d4bfbd1

PDB Entry: 4bfb, 2.21 Å

PDB Description: bace2 xaperone complex

PDB Compounds: (D:) xa4813

SCOPe Domain Sequences for d4bfbd1:

Sequence; same for both SEQRES and ATOM records:

>d4bfbd1 b.1.1.1 (D:165-270) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs

Timeline for d4bfbd1:

• d4bfbd1 first appeared in SCOPe 2.03, called d4bfbd_
  
• d4bfbd1 appears in SCOPe 2.07