Lineage for d4benc_ (4ben C:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450848Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 1450849Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)
  7. 1450850Species Actinomadura sp. [TaxId:1989] [144044] (16 PDB entries)
    Uniprot P39045 50-516
  8. 1450861Domain d4benc_: 4ben C: [201616]
    automated match to d2wked_
    complexed with gol, im2, mes, mg, so4

Details for d4benc_

PDB Entry: 4ben (more details), 2.15 Å

PDB Description: R39-imipenem Acyl-enzyme crystal structure
PDB Compounds: (C:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d4benc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4benc_ e.3.1.3 (C:) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape

SCOPe Domain Coordinates for d4benc_:

Click to download the PDB-style file with coordinates for d4benc_.
(The format of our PDB-style files is described here.)

Timeline for d4benc_: