Lineage for d4bcmd1 (4bcm D:176-308)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718587Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2718602Domain d4bcmd1: 4bcm D:176-308 [201607]
    Other proteins in same PDB: d4bcma1, d4bcma2, d4bcmc1, d4bcmc2
    automated match to d2cchb1
    complexed with sgm, t7z

Details for d4bcmd1

PDB Entry: 4bcm (more details), 2.45 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4bcmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcmd1 a.74.1.1 (D:176-308) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaa

SCOPe Domain Coordinates for d4bcmd1:

Click to download the PDB-style file with coordinates for d4bcmd1.
(The format of our PDB-style files is described here.)

Timeline for d4bcmd1: