| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d4bcmd1: 4bcm D:176-308 [201607] Other proteins in same PDB: d4bcma1, d4bcma2, d4bcmc1, d4bcmc2 automated match to d2cchb1 complexed with sgm, t7z |
PDB Entry: 4bcm (more details), 2.45 Å
SCOPe Domain Sequences for d4bcmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcmd1 a.74.1.1 (D:176-308) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaa
Timeline for d4bcmd1: