SCOPe 2.08: Domain d4bcmb1: 4bcm B:176-308

Lineage for d4bcmb1 (4bcm B:176-308)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d4bcmb1: 4bcm B:176-308 [201605]
   Other proteins in same PDB: d4bcma1, d4bcma2, d4bcmc1, d4bcmc2
   automated match to d2cchb1
   complexed with sgm, t7z

Details for d4bcmb1

PDB Entry: 4bcm, 2.45 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4bcmb1:

Sequence; same for both SEQRES and ATOM records:

>d4bcmb1 a.74.1.1 (B:176-308) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaa

Timeline for d4bcmb1:

• d4bcmb1 first appeared in SCOPe 2.03
  
• d4bcmb1 appears in SCOPe 2.07