SCOP 1.71: Domain d1cfvl_: 1cfv L:

Lineage for d1cfvl_ (1cfv L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1cfvl_: 1cfv L: [20160]
   Other proteins in same PDB: d1cfvh_
   part of Fv 4155
   complexed with e3g, zn

Details for d1cfvl_

PDB Entry: 1cfv, 2.1 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli

SCOP Domain Sequences for d1cfvl_:

Sequence; same for both SEQRES and ATOM records:

>d1cfvl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr

Timeline for d1cfvl_:

• d1cfvl_ first appeared (with stable ids) in SCOP 1.55
  
• d1cfvl_ appears in SCOP 1.69
  
• d1cfvl_ appears in SCOP 1.73
  
• d1cfvl_ appears in the current release, SCOPe 2.08