Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d4b9kh_: 4b9k H: [201598] Other proteins in same PDB: d4b9ka_, d4b9kb2, d4b9kc_, d4b9kd_, d4b9kf_, d4b9kg_, d4b9ki_, d4b9kj_, d4b9kk2, d4b9kl_ automated match to d2c9wc_ complexed with act, tg0 |
PDB Entry: 4b9k (more details), 2 Å
SCOPe Domain Sequences for d4b9kh_:
Sequence, based on SEQRES records: (download)
>d4b9kh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d4b9kh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgetnevnfreipshvlskvcmyftykvry tnssteipefpiapeialellmaanfldc
Timeline for d4b9kh_: