Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d4b9kg_: 4b9k G: [201597] Other proteins in same PDB: d4b9kb1, d4b9kb2, d4b9kc_, d4b9ke_, d4b9kf_, d4b9kh_, d4b9ki_, d4b9kk1, d4b9kk2, d4b9kl_ automated match to d4awjg_ complexed with act, tg0 |
PDB Entry: 4b9k (more details), 2 Å
SCOPe Domain Sequences for d4b9kg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b9kg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4b9kg_: