Lineage for d4b95l_ (4b95 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768925Domain d4b95l_: 4b95 L: [201590]
    Other proteins in same PDB: d4b95a_, d4b95b1, d4b95b2, d4b95d_, d4b95e1, d4b95e2, d4b95g_, d4b95h1, d4b95h2, d4b95i_, d4b95j_, d4b95k1, d4b95k2
    automated match to d1lqbc_
    complexed with act, uck

Details for d4b95l_

PDB Entry: 4b95 (more details), 2.8 Å

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4b95l_:

Sequence, based on SEQRES records: (download)

>d4b95l_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

Sequence, based on observed residues (ATOM records): (download)

>d4b95l_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvifanitlpvytlkerclqvvrslvkpenyrrldivrsly
edledhpnvqkdlerltqer

SCOPe Domain Coordinates for d4b95l_:

Click to download the PDB-style file with coordinates for d4b95l_.
(The format of our PDB-style files is described here.)

Timeline for d4b95l_: