Lineage for d1yehh1 (1yeh H:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451298Domain d1yehh1: 1yeh H:1-113 [20159]
    Other proteins in same PDB: d1yehh2, d1yehl1, d1yehl2
    part of Fab D2.5

Details for d1yehh1

PDB Entry: 1yeh (more details), 2.55 Å

PDB Description: structure of igg2a fab fragment

SCOP Domain Sequences for d1yehh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yehh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

SCOP Domain Coordinates for d1yehh1:

Click to download the PDB-style file with coordinates for d1yehh1.
(The format of our PDB-style files is described here.)

Timeline for d1yehh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yehh2