| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab D2.5 (mouse), kappa L chain [48831] (4 PDB entries) |
| Domain d1yehh1: 1yeh H:1-113 [20159] Other proteins in same PDB: d1yehh2, d1yehl2 complexed with zn |
PDB Entry: 1yeh (more details), 2.55 Å
SCOP Domain Sequences for d1yehh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yehh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss
Timeline for d1yehh1: