SCOPe 2.07: Domain d4b95k1: 4b95 K:18-112

Lineage for d4b95k1 (4b95 K:18-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (53 PDB entries)

8. Domain d4b95k1: 4b95 K:18-112 [201589]
   Other proteins in same PDB: d4b95a_, d4b95b2, d4b95c_, d4b95d_, d4b95e2, d4b95f_, d4b95g_, d4b95h2, d4b95i_, d4b95j_, d4b95k2, d4b95l_
   automated match to d2c9wc_
   complexed with act, uck

Details for d4b95k1

PDB Entry: 4b95, 2.8 Å

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound

PDB Compounds: (K:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4b95k1:

Sequence, based on SEQRES records:

>d4b95k1 d.42.1.1 (K:18-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf
tykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d4b95k1 d.42.1.1 (K:18-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsst
eipefpiapeialellmaanfldc

Timeline for d4b95k1:

• d4b95k1 first appeared in SCOPe 2.03, called d4b95k_
  
• d4b95k1 appears in SCOPe 2.06