Lineage for d4b95k1 (4b95 K:18-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945710Domain d4b95k1: 4b95 K:18-112 [201589]
    Other proteins in same PDB: d4b95a_, d4b95b2, d4b95c_, d4b95d_, d4b95e2, d4b95f_, d4b95g_, d4b95h2, d4b95i_, d4b95j_, d4b95k2, d4b95l_
    automated match to d2c9wc_
    complexed with act, uck

Details for d4b95k1

PDB Entry: 4b95 (more details), 2.8 Å

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
PDB Compounds: (K:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4b95k1:

Sequence, based on SEQRES records: (download)

>d4b95k1 d.42.1.1 (K:18-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf
tykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4b95k1 d.42.1.1 (K:18-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsst
eipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4b95k1:

Click to download the PDB-style file with coordinates for d4b95k1.
(The format of our PDB-style files is described here.)

Timeline for d4b95k1: