![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein VHL [49470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries) |
![]() | Domain d4b95f_: 4b95 F: [201587] Other proteins in same PDB: d4b95a_, d4b95b_, d4b95d_, d4b95e_, d4b95g_, d4b95h_, d4b95i_, d4b95j_, d4b95k_ automated match to d1lqbc_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95f_:
Sequence, based on SEQRES records: (download)
>d4b95f_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr slyedledhpnvqkdlerltq
>d4b95f_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda gthdgllvnqtelfvpsvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivrsl yedledhpnvqkdlerltq
Timeline for d4b95f_: