Lineage for d4b95a_ (4b95 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637478Protein Elongin B [54246] (2 species)
  7. 1637479Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)
  8. 1637503Domain d4b95a_: 4b95 A: [201582]
    Other proteins in same PDB: d4b95b_, d4b95c_, d4b95e_, d4b95f_, d4b95h_, d4b95i_, d4b95j_, d4b95k_, d4b95l_
    automated match to d1lm8b_
    complexed with act, uck

Details for d4b95a_

PDB Entry: 4b95 (more details), 2.8 Å

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
PDB Compounds: (A:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4b95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b95a_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp

SCOPe Domain Coordinates for d4b95a_:

Click to download the PDB-style file with coordinates for d4b95a_.
(The format of our PDB-style files is described here.)

Timeline for d4b95a_: