![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
![]() | Domain d4b95a_: 4b95 A: [201582] Other proteins in same PDB: d4b95b1, d4b95b2, d4b95c_, d4b95e1, d4b95e2, d4b95f_, d4b95h1, d4b95h2, d4b95i_, d4b95j_, d4b95k1, d4b95k2, d4b95l_ automated match to d1lm8b_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b95a_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp
Timeline for d4b95a_: