SCOPe 2.03: Domain d4b6sc_: 4b6s C:

Lineage for d4b6sc_ (4b6s C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
   automatically mapped to Pfam PF01220

6. Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)

7. Species Helicobacter pylori [TaxId:85962] [224882] (2 PDB entries)

8. Domain d4b6sc_: 4b6s C: [201577]
   Other proteins in same PDB: d4b6sa_
   automated match to d1j2ya_
   complexed with 2hn, po4

Details for d4b6sc_

PDB Entry: 4b6s, 1.9 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid

PDB Compounds: (C:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6sc_:

Sequence; same for both SEQRES and ATOM records:

>d4b6sc_ c.23.13.1 (C:) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 85962]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaq

Timeline for d4b6sc_:

• d4b6sc_ is new in SCOPe 2.03-stable
  
• d4b6sc_ appears in SCOPe 2.04
  
• d4b6sc_ appears in the current release, SCOPe 2.08