Lineage for d4b5da_ (4b5d A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811341Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)
  8. 1811352Domain d4b5da_: 4b5d A: [201572]
    automated match to d4b5dc_
    complexed with nag, sw4

Details for d4b5da_

PDB Entry: 4b5d (more details), 2.2 Å

PDB Description: capitella teleta achbp in complex with psychonicline (3-((2(s)- azetidinyl)methoxy)-5-((1s,2r)-2-(2-hydroxyethyl)cyclopropyl) pyridine)
PDB Compounds: (A:) capitella teleta achbp

SCOPe Domain Sequences for d4b5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b5da_ b.96.1.0 (A:) automated matches {Capitella teleta [TaxId: 283909]}
nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf
kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs
ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle
ilensaqrqevvypccesayvemkyllalrs

SCOPe Domain Coordinates for d4b5da_:

Click to download the PDB-style file with coordinates for d4b5da_.
(The format of our PDB-style files is described here.)

Timeline for d4b5da_: