Lineage for d4b36a_ (4b36 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928614Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)
  8. 2928622Domain d4b36a_: 4b36 A: [201562]
    automated match to d4b36b_
    complexed with cl

Details for d4b36a_

PDB Entry: 4b36 (more details), 1.76 Å

PDB Description: Crystal Structure of Human Angiogenin with an Engineered Loop Exhibits Conformational Flexibility at the Functional Regions of the Molecule
PDB Compounds: (A:) angiogenin, eosinophil cationic-related protein

SCOPe Domain Sequences for d4b36a_:

Sequence, based on SEQRES records: (download)

>d4b36a_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
nphrenlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldqsif
r

Sequence, based on observed residues (ATOM records): (download)

>d4b36a_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicnphre
nlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldqsifr

SCOPe Domain Coordinates for d4b36a_:

Click to download the PDB-style file with coordinates for d4b36a_.
(The format of our PDB-style files is described here.)

Timeline for d4b36a_: